Product Main

Quick Details

Model Number: CSB-EP005599HU
Place of Origin: China (Mainland)
Brand Name: Cusabio

Specifications

Product Name: Recombinant Homo sapiens (Human) Chymase
Product Type : Recombinant Protein
Code : CSB-EP005599HU
Size : 1mg/500ug/200ug/50ug/10ug
Uniprot NO. :
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
References : "Cloning of the gene and cDNA for human heart chymase." Urata H., Kinoshita A., Perez D.M., Misono K.S., Bumpus F.M., Graham R.M., Husain A. J. Biol. Chem. 266:17173-17179(1991)
Storage Buffer : 20mM Tris-HCl based buffer,pH8.0
Alias : Alpha-chymase Mast cell protease I
Species : Homo sapiens (Human)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Research Area : Cardiovascular
Source : E.coli
Gene Names : CMA1
Expression Region : 22-247aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : His-tag
Mol. Weight : 29.11kD
Protein Description : Full length of Chymase

Link: w w w . cusabio . c o m