Product Main

Quick Details

Model Number: CSB-EP357862SKY
Place of Origin: China (Mainland)
Brand Name: Cusabio

Specifications

Product Name: Recombinant Staphylococcus aureus (strain N315) Gamma-hemolysin component B
Product Type : Recombinant Protein
Code : CSB-EP357862SKY
Size : 1mg/500ug/200ug/50ug/10ug
Uniprot NO. :
Storage : Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance : Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity

References : "Shotgun proteomic analysis of total and membrane protein extracts of S. aureus strain N315." Vaezzadeh A.R., Deshusses J., Lescuyer P., Hochstrasser D.F. Submitted (OCT-2007)
Storage Buffer : 20mM Tris-HCl based buffer,pH8.0
Alias : H-gamma-1 H-gamma-I
Species : Staphylococcus aureus (strain N315)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Research Area : Microbiology

Source : E.coli
Gene Names : hlgB
Expression Region : 26-325aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : His-SUMO-tag
Mol. Weight : 50.1kD
Protein Description : Full length

Link: w w w . cusabio. com