References : "Cloning and expression of the human vasoactive intestinal peptide receptor." Sreedharan S.P., Robichon A., Peterson K.E., Goetzl E.J. Proc. Natl. Acad. Sci. U.S.A. 88:4986-4990(1991)
Storage Buffer : 20mM Tris-HCl based buffer,pH8.0
Alias : C-X-C chemokine receptor type 7 Short name: CXC-R7 Short name: CXCR-7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog Short name: RDC-1
Species : Homo sapiens (Human)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNK
Research Area : Signal Transduction

Source : E.coli
Gene Names : ACKR3
Expression Region : 1-40aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info : His-SUMO-tag
Mol. Weight : 20.52kD
Protein Description : Full length one of Extracellular

Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.